PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_025490_kdjm.t1
Common NameSOVF_025490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family MIKC_MADS
Protein Properties Length: 218aa    MW: 24932.4 Da    PI: 6.1685
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_025490_kdjm.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.81e-26957149
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       +ri+n + rqvtf+kRr+g++KKA+ELS+LCdaev +iifsstgk+ye 
  Sp_025490_kdjm.t1  9 ERIDNLTSRQVTFTKRRKGLFKKAKELSILCDAEVGIIIFSSTGKVYEI 57
                       69*********************************************95 PP

2K-box72.99.3e-2575169698
              K-box   6 gks..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                         ++  + +++a+ ++ e++ L++++e L+++ R+llGe+L++Ls+++L+ Le qLe + ++iR +K+e+++++i+el k e ++++en++L+
  Sp_025490_kdjm.t1  75 ENQvlNPTSEAQLWKVEAEGLRQQLEDLRKNSRQLLGEELSELSIEHLETLEAQLEMGTRSIRLRKEEIFKNKIQELNKTEIMVHQENMELH 166
                        44445778999********************************************************************************* PP

              K-box  96 kkl 98 
                        kk+
  Sp_025490_kdjm.t1 167 KKI 169
                        *98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.011161IPR002100Transcription factor, MADS-box
SMARTSM004327.5E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-30180IPR002100Transcription factor, MADS-box
CDDcd002651.36E-37274No hitNo description
PRINTSPR004041.2E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.5E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-2282169IPR002487Transcription factor, K-box
PROSITE profilePS5129713.76185175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MGRGKISIER IDNLTSRQVT FTKRRKGLFK KAKELSILCD AEVGIIIFSS TGKVYEIASH  60
CMQSLLERYY KANEENQVLN PTSEAQLWKV EAEGLRQQLE DLRKNSRQLL GEELSELSIE  120
HLETLEAQLE MGTRSIRLRK EEIFKNKIQE LNKTEIMVHQ ENMELHKKIN LMRQEMVELQ  180
KKNEVSGGQG KDDQEGGGAS SSAASAYDTY DPIELKLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-18277176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-18277176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-18277176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-18277176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A1e-18277176Myocyte-specific enhancer factor 2A
3kov_B1e-18277176Myocyte-specific enhancer factor 2A
3kov_I1e-18277176Myocyte-specific enhancer factor 2A
3kov_J1e-18277176Myocyte-specific enhancer factor 2A
3p57_A1e-18277176Myocyte-specific enhancer factor 2A
3p57_B1e-18277176Myocyte-specific enhancer factor 2A
3p57_C1e-18277176Myocyte-specific enhancer factor 2A
3p57_D1e-18277176Myocyte-specific enhancer factor 2A
3p57_I1e-18277176Myocyte-specific enhancer factor 2A
3p57_J1e-18277176Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691448.11e-136PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6EP491e-73MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A0K9RUZ71e-158A0A0K9RUZ7_SPIOL; Uncharacterized protein
STRINGGSMUA_Achr3P07310_0012e-75(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.15e-61AGAMOUS-like 21